PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02079.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 401aa    MW: 44809.8 Da    PI: 6.3265
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02079.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1322.6e-10203260562
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                              kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l  l+     l  e
  Rsa1.0_02079.1_g00004.1 203 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATTLSAQLTLLQRDTNGLSVE 260
                              9*******************************************99998877666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.6E-15199263IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.726201264IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-10203257No hitNo description
SuperFamilySSF579598.44E-11203254No hitNo description
PfamPF001705.2E-9203254IPR004827Basic-leucine zipper domain
CDDcd147031.19E-23204253No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MQTSELMDKE KSPAPPSGGG LPPPPPPPRY SAFSPNGSTF AMKPESFFPH NSDANMFSHD  60
ISRMSDNPPK NLGHRRAHSE ILTLPDDLSF DSDLGVVGAA DGPSFSDDTN EDLLSMYLDM  120
DKFNYSSEAS SSQMGCEPSE PAWRNELGSS SNERPRFRHQ HSQSMDGTTS IKPELLMSGS  180
NEVDSKKALS AAKLSELALI DPKRAKRIWA NRQSAARSKE RKMRYIAELE RKVQTLQTEA  240
TTLSAQLTLL QRDTNGLSVE NSELKLRVQS MEQQVHLQDA LNEALKEEVQ HLKVLTGQGV  300
SNGTSMMNYG SFGSNQQFYP NNQSRHAMLA AQQFQQLQIQ SQKQQQQQHH HHQQQLYQLQ  360
QQRIQQQELQ SGVTELRMPM SSSGQKECVP SPDLEAPSTK D
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013660628.10.0PREDICTED: probable transcription factor PosF21
SwissprotQ040881e-166POF21_ARATH; Probable transcription factor PosF21
TrEMBLA0A0D3DJ390.0A0A0D3DJ39_BRAOL; Uncharacterized protein
STRINGscaffold_100594.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24452772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-161bZIP family protein